Loading...
Statistics
Advertisement

Broken Arrow High School Class Of 1969, Broken Arrow, OK
www.bahs69.com/
This is the official web site for the Broken Arrow High School Class Of 1969

Bahs69.com

Advertisement
Conversion Technology Metas Server
Bahs69.com is hosted in United States / Dallas . Bahs69.com doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Iframe, Number of used javascripts: 8. First javascripts: Jquery-1.8.2.min.js, Blockui.js, Jquery.validate.js, Number of used analytics tools: 2. First analytics tools: Facebook Retargeting, Google Analytics, Its server type is: Microsoft-IIS/8.0.

Technologies in use by Bahs69.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Iframe
  • Javascript
  • jQuery
  • jQuery Validate

Advertisement

Javascripts

Number of occurences: 8
  • jquery-1.8.2.min.js
  • blockui.js
  • jquery.validate.js
  • jquery.popupWindow.js
  • swfobject.js
  • hoverIntent.js
  • superfish2.js
  • widgets.js

Analytics

Number of occurences: 2
  • Facebook Retargeting
  • Google Analytics

Server Type

  • Microsoft-IIS/8.0

Powered by

  • ASP.NET

Social

Number of occurences: 1
  • Facebook Box

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bahs69.com

Missing HTTPS protocol.

    Meta - Bahs69.com

    Number of occurences: 14
    • Name:
      Content: This is the official web site for the Broken Arrow High School Class Of 1969
    • Name: viewport
      Content: user-scalable = yes
    • Name: author
      Content: Bill Coleman
    • Name: subject
      Content: Broken Arrow High School Class Web Site
    • Name: classification
      Content: Broken Arrow High School Class Of 1969, Broken Arrow, OK
    • Name: keywords
      Content: Broken Arrow High School, Class Of 1969, Broken Arrow, OK, Bill Coleman
    • Name: geography
      Content: Broken Arrow, OK
    • Name: copyright
      Content: Bill Coleman
    • Name: designer
      Content: Bill Coleman
    • Name: publisher
      Content: Broken Arrow High School Class Of 1969
    • Name: distribution
      Content: global
    • Name: city
      Content: Broken Arrow
    • Name: country
      Content: USA
    • Name: description
      Content: This is the official web site for the Broken Arrow High School Class Of 1969

    Server / Hosting

    • IP: 69.41.171.62
    • Latitude: 32.78
    • Longitude: -96.82
    • Country: United States
    • City: Dallas

    Rname

    • dns2.name-services.com
    • dns3.name-services.com
    • dns5.name-services.com
    • dns1.name-services.com
    • dns4.name-services.com

    Target

    • info.name-services.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html;charset=UTF-8 Server: Microsoft-IIS/8.0 P3P: CP="CURa ADMa DEVa CONo HISa OUR IND DSP ALL COR" Set-Cookie: ATOM=%7Bts%20%272016%2D09%2D04%2009%3A25%3A37%27%7D; Expires=Mon, 05-Sep-2016 13:25:37 GMT; Path=/ X-Powered-By: ASP.NET Date: Sun, 04 Sep 2016 13:25:37 GMT X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Transfer-Encoding: chunked Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

    DNS

    host: bahs69.com
    1. class: IN
    2. ttl: 1800
    3. type: A
    4. ip: 69.41.171.62
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns2.name-services.com
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns3.name-services.com
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns5.name-services.com
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns1.name-services.com
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns4.name-services.com
    host: bahs69.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: dns1.name-services.com
    5. rname: info.name-services.com
    6. serial: 1446771189
    7. refresh: 172800
    8. retry: 900
    9. expire: 1814400
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ahs69.com, www.bqahs69.com, www.qahs69.com, www.bwahs69.com, www.wahs69.com, www.bzahs69.com, www.zahs69.com, www.bxahs69.com, www.xahs69.com, www.bahs69.com, www.ahs69.com, www.bsahs69.com, www.sahs69.com, www.byahs69.com, www.yahs69.com, www.beahs69.com, www.eahs69.com, www.bdahs69.com, www.dahs69.com, www.bcahs69.com, www.cahs69.com, www.bhs69.com, www.baohs69.com, www.bohs69.com, www.baphs69.com, www.bphs69.com, www.ba9hs69.com, www.b9hs69.com, www.bahs69.com, www.bhs69.com, www.baihs69.com, www.bihs69.com, www.bauhs69.com, www.buhs69.com, www.bas69.com, www.bahes69.com, www.baes69.com, www.bahds69.com, www.bads69.com, www.bahcs69.com, www.bacs69.com, www.bahus69.com, www.baus69.com, www.bahjs69.com, www.bajs69.com, www.bahs69.com, www.bas69.com, www.bahbs69.com, www.babs69.com, www.bahgs69.com, www.bags69.com, www.bah69.com, www.bahse69.com, www.bahe69.com, www.bahsw69.com, www.bahw69.com, www.bahsd69.com, www.bahd69.com, www.bahsx69.com, www.bahx69.com, www.bahsf69.com, www.bahf69.com, www.bahsg69.com, www.bahg69.com, www.bahst69.com, www.baht69.com, www.bahs9.com, www.bahs6r9.com, www.bahsr9.com, www.bahs6t9.com, www.bahst9.com, www.bahs6z9.com, www.bahsz9.com, www.bahs6y9.com, www.bahsy9.com, www.bahs649.com, www.bahs49.com, www.bahs6.com, www.bahs69u.com, www.bahs6u.com, www.bahs69o.com, www.bahs6o.com, www.bahs69i.com, www.bahs6i.com, www.bahs697.com, www.bahs67.com,

    Other websites we recently analyzed

    1. ex
      Kjetil Kausland
      Norway - 194.63.248.96
      Server software: Apache/2.2.22
      Technology: CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 5
    2. Tecno-lac Industrias Químicas para la Madera
      Tecno-Lac es una empresa de hoy, fundada para dar la mejor respuesta al sector de recubrimientos de la madera, preparada para fabricar barniz con la más avanzada técnica disponible en el mercado
      Spain - 217.76.132.226
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Html, Javascript
      Number of meta tags: 3
    3. kentong.ca
      Jacksonville (United States) - 206.188.193.238
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cycle, Php
      Number of Javascript: 5
      Number of meta tags: 1
    4. Acceuil Michael.W.Savard
      Houston (United States) - 192.185.92.223
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 5
    5. naturaldogdeli.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    6. Home Page
      Dublin (Ireland) - 46.51.204.184
      Server software: nginx
      Technology: CloudFront, CSS, Google Font API, Html
      Number of Javascript: 5
      Number of meta tags: 5
    7. 9¸æž°è¡¾æ»ž
      Ottawa (Canada) - 47.90.10.47
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php
      Number of Javascript: 15
      Number of meta tags: 3
    8. drawwritenow.com
      Lansing (United States) - 67.225.133.85
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    9. İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
      İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
      Germany - 146.0.42.37
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, jQuery Fancybox, Php, SuperFish
      Number of Javascript: 16
      Number of meta tags: 10
    10. Danny's Pizza | A Great Restaurant in Douglas, Georgia
      Scottsdale (United States) - 184.168.165.1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, WordPress Stats, Wordpress
      Number of Javascript: 14
      Number of meta tags: 4

    Check Other Websites